PLUNC-like gene repertoire in chickens reveals the absence of a LBP gene

Developmental and Comparative Immunology 35 (2011) 285–295

Contents lists available at ScienceDirect

Developmental and Comparative Immunology journal homepage: www.elsevier.com/locate/dci

Identification and characterisation of the BPI/LBP/PLUNC-like gene repertoire in chickens reveals the absence of a LBP gene夽 Shih-Chieh Chiang a,1 , Edwin J.A. Veldhuizen b , Frances A. Barnes a , C. Jeremy Craven c , Henk P. Haagsman b , Colin D. Bingle a,∗ a b c

Academic Unit of Respiratory Medicine, Department of Infection and Immunity, University of Sheffield, Sheffield S10 2JF, UK Department of Infectious Diseases and Immunology, Faculty of Veterinary Medicine, Utrecht University, P.O. Box 80.165, 3508 TD Utrecht, The Netherlands Krebs Institute for Biomolecular Research, Department of Molecular Biology and Biotechnology, University of Sheffield, Sheffield S10 2TN, UK

a r t i c l e

i n f o

Article history: Received 26 August 2010 Received in revised form 28 September 2010 Accepted 28 September 2010 Available online 16 October 2010 Keywords: Innate immunity BPI LBP PLUNC Comparative genomics Avian

a b s t r a c t Palate, lung and nasal epithelial clone (PLUNC) proteins are structural homologues to the innate defence molecules LPS-binding protein (LBP) and bactericidal/permeability-increasing protein (BPI). PLUNCs make up the largest portion of the wider BPI/LBP/PLUNC-like protein family and are amongst the most rapidly evolving mammalian genes. In this study we systematically identified and characterised BPI/LBP/PLUNC-like protein-encoding genes in the chicken genome. We identified eleven complete genes (and a pseudogene). Five of them are clustered on a >50 kb locus on chromosome 20, immediately adjacent to BPI. In addition to BPI, we have identified presumptive orthologues LPLUNCs 2, 3, 4 and 6, and BPIL-2. We find no evidence for the existence of single domain containing proteins in birds. Strikingly our analysis also suggests that there is no LBP orthologue in chicken. This observation may in part account for the relative resistance to LPS toxicity observed in birds. Our results indicate significant differences between the avian and mammalian repertoires of BPI/LBP/PLUNC-like genes at the genomic and transcriptional levels and provide a framework for further functional analyses of this gene family in chickens. Crown Copyright © 2010 Published by Elsevier Ltd. All rights reserved.

1. Introduction LPS, a major component of the outer membrane of Gramnegative bacteria, is a potent immunogenic molecule to mammals. Exaggerated host immune response to LPS can lead to shock, multi-organ failure and death. LPS-binding protein (LBP) and bactericidal/permeability-increasing protein (BPI) are two extensively investigated proteins in mammals due to their central role in regulating LPS presentation to neutrophils and subsequent inflammatory response. Although structurally similar, LBP and BPI have opposing effects on LPS-mediated inflammatory response. LBP promotes inflammatory response by catalysing binding of LPS monomers to CD14 on the cell surface, and together with Toll-like receptor 4 (TLR-4), mediates activation of these cells and clearance of LPS from the host (Fenton and Golenbock, 1998; Hailman et al., 1994; Weiss, 2003). On the other hand, BPI is a bacterici-

夽 This work was funded by a grant from the Wellcome Trust to CDB. ∗ Corresponding author. Tel.: +44 0 114 271 2638; fax: +44 0 114 228 8898. E-mail address: c.d.bingle@sheffield.ac.uk (C.D. Bingle). 1 Current address: G3.20 Genome Damage and Stability Centre University of Sussex, Science Park Road, Brighton BN1 9RQ, UK.

dal protein that also exhibits anti-inflammatory activity through high affinity binding with, and neutralisation of LPS, and which in conjunction with other host factors results in arrest of bacterial growth and phagocytosis by neutrophils (Weiss, 2003; Elsbach and Weis, 1998). In addition to LBP and BPI, this family of lipid transfer proteins also includes phospholipid transfer protein (PLTP) and cholesterol ester transfer protein (CETP), two proteins important in promoting the exchange of neutral lipids and phospholipids between the plasma lipoproteins (Masson et al., 2009). In keeping with their shared structure, both BPI and CETP have been shown to co-crystalize with lipids. BPI and CETP adopt two structurally homologous domains and each contains a hydrophobic pocket, which binds lipids (Beamer et al., 1997; Qiu et al., 2007). In keeping with the proposed lipid binding/transfer function of members of the BPI/LBP/CETP/PLTP family, insect juvenile hormone binding protein binds to the highly hydrophobic juvenile hormone with high affinity (Kolodziejczyk et al., 2008). Recently the crystal structure of Epihyas postvittana Takeout1 was solved with a bacterial lipid present in the conserved hydrophobic cleft (Hamiaux et al., 2009) further supporting a lipid binding role for proteins with this fold. Additional structurally related molecules have also been identified in the pacific oyster (Gonzalez et al., 2007), trypanosomes (Barker et al., 2008) and in worms (Oishi et al., 2009) confirm-

0145-305X/$ – see front matter. Crown Copyright © 2010 Published by Elsevier Ltd. All rights reserved. doi:10.1016/j.dci.2010.09.013

286

S.-C. Chiang et al. / Developmental and Comparative Immunology 35 (2011) 285–295

ing the widespread distribution of this fold throughout the animal kingdom. Our identification and description of the palate, lung and nasal epithelial clone (PLUNC) proteins has greatly enlarged the BPI/LBP/CETP/PLTP protein family (Bingle and Craven, 2002, 2004; Bingle et al., 2004). In fact the PLUNC branch makes up the largest portion of the family which can therefore be called the BPI/LBP/PLUNC-like family. PLUNC was first described in the nasal epithelium of the mouse embryo and the trachea/bronchi of adult mice (Weston et al., 1999). We made the key observation that PLUNC belongs to a family of genes located in a single locus on human chromosome 20q11 (Bingle and Craven, 2002, 2004; Bingle et al., 2004; Wheeler et al., 2007). We showed that PLUNCs make up the largest branch of this family and can be classified into long PLUNC (LPLUNC) or short PLUNC (SPLUNC). LPLUNCs exhibit homology to both the N-terminal and C-terminal domains of BPI whereas SPLUNCs exhibit structural homology to the Nterminal domain of BPI (containing the LPS-binding motif) (Bingle and Craven, 2002, 2004; Bingle et al., 2004). We have previously shown that SPLUNCs evolved by partial duplication of a LPLUNC gene and have rapidly evolved to yield a diverse gene set in different mammals (Bingle and Craven, 2002, 2004; Bingle et al., 2004; Wheeler et al., 2007). Although the function of PLUNC proteins is not known, there has been accumulating evidence suggesting that they may play a role in host innate immunity. The findings that human SPLUNC1 binds to Escherichia coli LPS (Ghafouri et al., 2003) and that rat parotid secretory protein (the orthologue of human SPLUNC2) can complex with bacterial membranes (Robinson et al., 1997) support a role for direct interaction with LPS. There is conflicting data on a direct anti-microbial role for SPLUNCs but there is some evidence that SPLUNCs attenuate the growth of a range of organisms (Geetha et al., 2003; Chu et al., 2007; Haigh et al., 2008). The observation that PLUNCs are amongst the most rapidly evolving mammalian genes and the presence of species-specific members of the PLUNC family suggests evolution may have been driven through interaction with species-specific pathogens (Bingle et al., 2004; Wheeler et al., 2007). On the basis of genomic and EST data available at the time we initially proposed that PLUNCs were restricted to mammals (Bingle et al., 2004). However, studies have characterised two PLUNC-related genes in chicken, Transiently Expressed in Neural Precursors (TENP) and Ovocalyxin-36. TENP is expressed in embryonic chicken brain and retina, specifically in postmitotic cells before they enter the stage of differentiation (Yan and Wang, 1998). The discovery of TENP predated our identification of PLUNCs but our phylogenetic analysis could not robustly place it within the PLUNC sub-branch of the wider family (Bingle et al., 2004). Proteomic analysis of hen egg white subsequently revealed the presence of TENP in a significant quantity (approximately 0.1–0.5%) (Guérin-Dubiard et al., 2006). Ovocalyxin-36 is another protein with sequence homology to LBP, BPI and PLUNC (Gautron et al., 2007). Ovocalyxin-36 was suggested to be an egg-shell specific protein and was shown to contain both the N-terminal and Cterminal BPI-like homology domains. The exon/intron structure of Ovocalyxin-36 was also shown to be very similar to LBP and BPI (and consequently to PLUNCs). In addition, Ovocalyxin-36 is located on chromosome 20, which is syntenic to the portion of human chromosome 20 (International Chicken Genome Sequencing Consortium, 2004) where LBP and BPI are located, suggesting a common ancestral origin before the divergence of mammalian and avian lineages (International Chicken Genome Sequencing Consortium, 2004). Proteomic analysis has detected Ovocalyxin-36 in the vitalline membrane, egg shell, uterus and red isthmus of the female reproductive tract (Mann, 2008). In addition to these two proteins chicken CETP and PLTP have also been cloned (Sato et al., 2007; Saarelaa et al., 2009).

On the basis of these observations and using the availability of an improved chicken genome assembly and the large chicken EST database we now report the systematic identification and expression analysis of BPI/LBP/PLUNC-like genes in the chicken. Our results indicate significant differences between the avian and mammalian repertoires of BPI/LBP/PLUNC-like genes at the genomic and transcriptional levels. Key amongst these are the apparent lack of an avian LBP gene and the lack of any single BPI-domain containing (SPLUNC-like) proteins. These observations provide a framework for further functional analyses of this gene family in chickens. 2. Materials and methods 2.1. Database searching The chicken Ensembl database (release 49, March 2008) was initially searched for known and predicted proteins containing the InterPro LBP BPI CETP protein domain (IPR001124). We also searched for Genscan gene predictions and performed an extensive sequence based iterative analysis using NCBI BLAST as previously outlined (Bingle et al., 2004). To identify the genomic localisation of each gene we utilised data from Ensembl as well as direct mapping of the predicted transcripts onto the genomic sequence using the BLAST-like alignment tool (BLAT) (Kent, 2002). Gaps in the current chicken genome assembly (v.2.1 May 2006) that affected the prediction of exon numbers and sizes for a number of the genes, were closed by PCR based amplification, cloning and sequencing as outlined below. For phylogenetic analysis and the assignment of orthology we also collected a range of related sequences from a range of sources. 2.2. EST and genomic sequencing, PCR primer design and genomic PCR We aimed to generate confirmatory evidence for the existence of all of the identified genes. Where ESTs partially supporting these genes existed in the database (Table 1) these were obtained and fully sequenced using an ABI DNA Analyser 3730 capillary sequencer. The sequences of the full-length ESTs and predicted transcripts were used as templates for designing internal oligonucleotide primers for use in PCR-based cloning so as to obtain the complete transcript and genomic sequences of each predicted gene. We used Primer3 (http://primer3.sourceforge.net/) to select primer sets for each transcript (Table 2). All primers were chosen with a default annealing temperature of 60 ◦ C. Where gaps were noted in the genomic assembly we generated overlapping primer sets and used these for PCR with high fidelity Taq polymerase (AccuPrime, Invitrogen) using chicken genomic DNA as a template. The resultant products were cloned in pCRII Topo (Invitrogen), mini prepped and sequenced as above. Large inserts were sequenced with internal specific primers as required. The primers used for this amplification and for sequencing are also listed in Table 2. 2.3. Sequence analysis Using the fully sequenced genomic and transcript information, the exon numbers and sizes of each PLUNC gene were determined. The predicted protein sequences were generated from sequences of full-length ESTs wherever possible, or from a combination of EST sequences, Ensembl predicted transcript sequences and NCBI GenBank predicted peptide sequences. Six-frame translations were generated by ExPASy Translate Tool and searched against the NCBI peptide sequences using protein BLAST (Altschul et al., 1990) to identify the best prediction. This analysis allowed the resolution of all intron exon boundaries.

S.-C. Chiang et al. / Developmental and Comparative Immunology 35 (2011) 285–295

287

Table 1 Chicken genes and predicted proteins containing LBP BPI CETP domains. Description

Peptide ID

Ensembl gene ID

Location

Sequenced ESTs

Gap closure required

BPIL2a BPIL2b CETP BPI/LBP Ovocalyxin-36 TENP LPLUNC6 LPLUNC3 LPLUNC4 Protein 10 BPI PLTP

XP 425484 XP 001234743 NP 001029986 XP 417449.2 NP 001026032 NP 990357 XP 417463.2 XP 425718 – – XP 417465.2 XP 425722

ENSGALG00000012602 ENSGALG00000023111 ENSGALG00000001234 ENSGALG00000021025 ENSGALG00000006662 ENSGALG00000006666 ENSGALG00000006674 ENSGALG00000020982 ENSGALG00000006679 ENSGALG00000006693 ENSGALG00000006756 ENSGALG00000006894

Chr1:49,966,319-49,998,072 Chr1:55,310,190-55,322,401 Chr11:611,151-616,777 Chr20:9,964,037-9,966,515 Chr20:10,238,414-10,246,457 Chr20:10,247,698-10,251,922 Chr20:10,253,409-10,260,128 Chr20:10,263,408-10,268,038 Chr20:10,270,264-10,275,479 Chr20:10,279,239-10,282,757 Chr20:10,293,925-10,301,731 Chr20:10,491,966-10,496,062

DT655663 BU432695 – – CD217547 DT657764 CD216397 BU362274 – BU136253 BM491427 –

– – – Yes – Yes Yes – – – Yes –

The full-length protein sequences were then ClustalW aligned (Thompson et al., 1994) with sequences of human and mouse LPLUNCs and with a selection of BPI/PLUNC related proteins from cow, frog, some fish species and a single oyster protein. The sequences used in this analysis and their origins are shown in Fig. 2. A neighbour-joining phylogenetic tree was generated to assess the general branching of the BPI/PLUNC family and to identify the orthologues of the chicken proteins. The underlying tree was created using clustalW, a preliminary representation was made using phylip (Felsenstein, 1989) and the final tree was created using inhouse software. 2.4. Expression analysis We established RT-PCR conditions for each chicken transcript using cDNA generated from pooled commercial RNA samples (Zyagen, USA). Tissues used were brain, heart, lung, kidney, liver, small intestine, colon, testes and skeletal muscle. Reverse transcription

was performed using standard protocols, in a total volume of 20 ␮l using an oligo-dT primer and 1 ␮g of pooled total RNA. PCR reactions were performed using 1 ␮l of each reaction product. PCR conditions and the required number of cycles were determined empirically. Reaction products were resolved on 1–2% TAE agarose gels and subsequently cloned and sequenced for verification purposes. To investigate expression of each gene in a wider range of tissues total RNA was extracted from 40 tissues of healthy ROSS 308 broiler chicken using TRIzol (Invitrogen) and Magnalyser Green Beads (Roche Diagnostics) following manufacturer’s directions. 1 ␮g of RNA was DNAse I-treated (Fermentas) and was reverse transcribed using iScript cDNA synthesis kit (Bio-Rad Laboratories). The cDNA was standardised using primers for the housekeeping gene ␤-actin in PCR, and all subsequent PCRs were done using FastStart DNA Taq polymerase, dNTP pack (Roche Diagnostics). Thermocycling comprised of initial denaturation of 95 ◦ C for 5 min, followed by 40 cycles of 95 ◦ C for 40 s, 60 ◦ C for 1 min, 72 ◦ C for 1 min, then a final

Table 2 Oligonucleotide primers for each chicken gene. Gene

Name

Sequence (5 –3 )

Use

BPI

RT-F RT-R GF-1 GF-2 GR-1 SeqF SeqR RT-F RT-R RT-F RT-R GF-1 GR-1 RT-F RT-R RT-F RT-R RT-F RT-R RT-F RT-R RT-F RT-R RT-F RT-R RT-F RT-R GF-1 GR-1 SeqF SeqR RT-F RT-R

GAGTGGTGCTGGATGTGTTCCTGGT ACGGCGCTATAGAAGAGGTTG GAGTGGTGCTGGATGTGTTTC GGGGAAGGTGCACTATGAGAT ACGGCGCTATAGAACAGGTTG CCCACCCCACTGTACTGTCT CATGGGAGAACCTGTGTCCT ACGTCTCAATGCTGTTGCAG ATCCTGACCGGATCTCCTCT TCCGAGCACTTCTACACCAG CCAAGATCAGGGTTGGAAGA AACTGCCAGCTCCAGTACC TCCGAGCACTTCTACACCAG ACACAGACCCTCCCTTTGTG TGTTGTCAGATTCCCCGTAA TTCCGACCGTACATTGACAT GTGGCCGTTAGCTTCATCAT GTGCTGAATGAGAGCGATGT ATTGAAAAGCCAAGGGGAGA GCTGCTGAAAATCGCAGTTC CAAACTGAGCCAGCAAGGAC GTTCTGGACATCACCCCATC TACATCAGCCAAGTCCACCT GTGTGTCATGGAAGGTGCTG CTTTTTTATTGCCAGGAGCA CACTCACATGGGAAGTGGAC ACCGCCAGGTCCCTGATAC ATGGACATTGGCGTCACAG CAGGTGGCATTGAGCTGGAT ATCCTTCTGCTCCTCAGTTG ACAGCCACATCCCCCGGGTT ACCCTGTCCTGCTTACTGAGG TCCCAATGGTGATCACCTGCC

RT-PCR RT-PCR Genomic PCR Genomic PCR Genomic PCR Sequencing Sequencing RT-PCR RT-PCR RT-PCR RT-PCR Genomic PCR Genomic PCR RT-PCR RT-PCR RT-PCR RT-PCR RT-PCR RT-PCR RT-PCR RT-PCR RT-PCR RT-PCR RT-PCR RT-PCR RT-PCR RT-PCR Genomic PCR Genomic PCR Sequencing Sequencing RT-PCR RT-PCR

Ovocalyxin-36 TENP/LPLUNC2

BPIL-2R1 BPIL-2R2 LPLUNC6 LPLUNC4 LPLUNC3 Protein 12 Protein 11

␤-Actin

288

S.-C. Chiang et al. / Developmental and Comparative Immunology 35 (2011) 285–295

extension of 72 ◦ C for 5 min. The outcome was assessed by 1% TAE agarose electrophoresis using ethidium bromide for visualisation under an ultraviolet transilluminator. 3. Results 3.1. Identification of chicken BPI/LBP/PLUNC-like family members As comparative genomic analysis of the mammalian BPI/LBP/PLUNC-like genes has shown low sequence identities between orthologous pairs (Bingle et al., 2004), identification of PLUNC orthologues in more divergent vertebrate species including the chicken relies primarily upon conservation of functional protein domains (the LBP BPI CETP domain) and exon sizes. Searching of the Ensembl database for known and predicted proteins containing the InterPro LBP BPI CETP protein domain (IPR001124) identified eleven potential genes. Noting that eight out of eleven of the predicted genes cluster on chromosome 20, which is partially syntenic to chromosome 20 in human and chromosome 2 in mouse, where BPI and LBP are located, we searched for additional candidate genes in the Genscan gene predictions database. This search identified one additional gene prediction (which also has the Ensembl identity, ENSGALG00000006693). To complete the bioinformatic analysis we performed an extensive sequence based iterative analysis using NCBI BLAST. In total therefore we have identified 12 distinct genes in the chicken genome. Details of these genes are provided in Table 1 and a detailed description of assignment of orthology is given below. As expected this list contains the 4 previously identified chicken genes, CETP, PLTP, Ovocalyxin-36 and TENP. Six of the genes including Ovocalyxin-36 and TENP are clustered on an approximately 60 kb locus on chromosome 20. Three further genes (including the orthologues of BPI and PLTP) are also found on chromosome 20. A further two genes, which we show below to encode orthologues of human BPIL2, (Mulero et al., 2002), are present on chromosome 1 while CETP is found on chromosome 11. The overall architecture of the PLUNC-like locus and its relationship to the human locus is shown in Fig. 1. This shows that 5 of the genes are transcribed in a centromeric-to-telomeric direction with the exception being TENP, which runs in the opposite direction. Analysis of this region of the zebra finch genome suggests the same orientation for the TENP gene in that species (results not shown) and this therefore represents the only reported instance of a member of this family within the conserved “PLUNC” locus running in the opposite direction with respect to all other genes. The general organisation of this region is very similar to a portion of the mammalian PLUNC locus encoding orthologous genes. CDK5RAP1 is in the appropriate synteneic region of the chromosome and flanks the locus at the telomeric end. In the chicken locus CDK5RAP1 is adjacent to BPI. In mammals these two genes are separated by approximately 5 Mb of genomic DNA and sequence syntenic to this portion of the mammalian genome is located approximately 8 Mb centromeric to this region in chicken suggesting a major reorganization has occurred in this portion of the chromosome. 3.2. Characterisation of gene structure With systematic PCR-based sequencing of unknown genomic and cDNA segments within the predicted genes, the consensus transcript sequence, exon numbers and sizes were confirmed for most candidate chicken BPI/LBP/PLUNC-like genes. For some of these genes we were unable to predict the position and size of the presumptive 5 and 3 non-coding exons. The four gaps in the genomic assembly that were identified as potentially affecting exon predictions were bridged by PCR as described below.

Alignment of the complete sequence of chicken BPI with the genome assembly revealed that the 5 end of the gene was missing. Amplification and cloning of this region by PCR allowed the identification of exons 3 and 4 and the confirmation of the size of exon 5. The complete structure of the 5 end of the cBPILBP gene was also absent from the assembly. To confirm this we aligned the sequence of the NCBI prediction (XP 417449.2) to the genome to generate locations of PCR primers. Amplification and cloning of this region by PCR allowed the identification of exons 2 and 3. Alignment of the published cDNA sequence of TENP identified a gap in the assembly that included exons 9–12. PCR based cloning and sequencing confirmed the size and location of these exons. Alignment of the cDNA of LPLUNC6 (generated by fully sequencing EST CD216397) identified a gap at the 3 end of the gene. Because there was a further EST (BM490026) with a different predicted exon organisation at the 3 end (where exon 16 of >165 bp is replaced by 2 exons of 64 bp and >102 bp) we closed this gap to confirm that there were no other predicted exons in this region. Table 1 summarises the gene information for the chicken BPI/LBP/PLUNC-like genes. The nomenclature that we have adopted in this paper was derived from the exon size information, physical location and phylogenetic analysis that is outlined in detail below. All candidate BPI/LBP/PLUNC-like protein genes have two LBP BPI CETP domains and most appear to have 16 exons. Importantly, there are no genes that encode SPLUNC proteins in the chicken genome. As was noted in our previous analysis of the gene family in mammals (Bingle et al., 2004) many of the exons have (near) identical sizes (Table 3). The two major exceptions to this rule in chicken are CETP and P10 (the product of ENSGALG00000006693). The cloning of chicken CETP has previously been described (Sato et al., 2007). Analysis of the CETP gene shows that the sequence that is equivalent to exon 5 in all other BPI/LBP/PLUNC-like genes is represented by 2 exons of 71 and 88 bases. This genomic organisation has previously been reported in mammalian CETP genes and our analysis shows that it is also found in the zebra finch (Taeniopygia guttata), the pipid frog (Silurana tropicalis) and zebrafish (Danio rerio) CETP orthologues (results not shown). P10 shares some sequence homology with PLUNCs but lacks a complete predicted LBP BPI CETP domain. Sequencing the fulllength of its supporting EST (BU136253) shows that it has a much shorter transcript length than other candidate PLUNCs. Genscan and BLASTp searches within the region identified an alternatively spliced prediction of 6 exons (XP 001235157), two of which 61 bp and 92 bp, are shared with the EST sequence. This prediction in many ways produces a more “PLUNC” like product but there is no EST support for this transcript and we were unable to amplify the corresponding transcript by PCR from pooled cDNAs (results not shown). As neither of the two gene predictions appear to encode a complete LBP BPI CETP domain it is likely that this gene represents an expressed pseudogene. 3.3. Comparative analysis Phylogenetic analysis of chicken BPI/LBP/PLUNC-like proteins with those of human, mouse, cow, zebra finch, Xenopus laevis, oyster and some fish species clearly identifies the presence of chicken orthologues of CETP, PLTP, BPI and BPIL2 (Fig. 2). The chicken genome encodes two BPIL2 related genes which we have designated BPIL2a and BPIL2b (Fig. 2). The exon sizes of these two genes are almost identical and the proteins that they encode are 46% identical. The 5 complete genes present within the “PLUNC” locus are most closely related to each other in terms of sequence identity. Two of these genes are Ovocalyxin-36 and TENP. Assignment of orthology to these 5 proteins is somewhat difficult due to the low sequence

S.-C. Chiang et al. / Developmental and Comparative Immunology 35 (2011) 285–295

289

Fig. 1. Organisation of the BPI/LBP/PLUNC-like gene locus in chickens. Schematic representation of the human PLUNC and chicken BPI/LBP/PLUNC-like loci. The lower panel indicates the organisation of the chicken locus on Chromosome 20, whereas the upper panel represents the human locus (adapted from Wheeler et al., 2007). Arrows between the two loci indicate orthologous relationships described in the text. The position of the locus on the chromosome is indicated by the grey arrow-heads and nucleotide numbers of the assembled chicken chromosome, obtained from the UCSC BLAT genome browser (http://genome.ucsc.edu/). The solid bars above the locus indicate the positions of gaps in the assembly that were closed in this study. The cross hatches at either end of the locus indicate breaks in the sequence introduced for clarity. The arrowed end of each gene indicates the direction of the ORF. Intact BPI/LBP/PLUNC-like (BPIL) genes are shaded while the pseudogene (P10) is hatched. The unrelated gene CDK5RAP1 is not filled. The black scale bars indicate either 50 kb or 10 kb.

similarity that they share with the mammalian proteins. However, on the basis of phylogeny three of the proteins can be assigned as 1–1 orthologues of hLPLUNC3, hLPLUNC4 and hLPLUNC6. Our assignment of orthology is also supported both by exon size conservation and position within the locus. For example LPLUNC4 genes have a characteristically small exon 3 (63 bp) that is found in all species (Bingle et al., 2004). Consistent with our observation from other species the sequence similarity of hLPLUNC4 and cLPLUNC4 is strongest of all (Bingle et al., 2004). The orthology of TENP and Ovocalyxin-36 is less clear but on the same basis we would suggest that TENP is a divergent orthologue of LPLUNC2. The fact that Ovocalyxin-36 is located next to TENP suggest that they may have evolved by duplication from an ancestral LPLUNC2-related gene. TENP has the least conserved exon sizes of any of the chicken genes. Finally there remains an outlier protein, which, despite a fairly conserved exon size pattern, does not appear to have any clear

orthologous relationship to BPI, LBP or to any mammalian PLUNC proteins. On this basis we have given this protein the designation cBPI/LBP to show that it is related to but distinct from member of these sub-branches of the wider family. One of the important outcomes from this phylogenetic analysis is that it fails to identify a chicken protein that is clearly orthologous to LBP. In all mammals the LBP is located within a few kb of the gene encoding BPI (Weiss, 2003; Bingle and Craven, 2004). LBP is also highly expressed in the liver and is represented by hundreds of mammalian ESTs. Genomic databases contain no additional protein predictions (either complete or partial) and we could identify no additional predicted related proteins when the chicken EST database was examined using tblastn. A clear LBP orthologue is also absent from the zebra finch genome (results not shown). Our conclusion is that there is no avian LBP orthologue. However, it should be pointed out that the region of the chicken genome that

Table 3 Exon sizes of chicken BPI/LBP/PLUNC-like genes. Bold exon sizes were determined after aligning cDNA sequences to sequenced gaps present in the chicken genome assembly. Exon no. BPIL2a BPIL2b CETP BPI/LBP Ovocalyxin-36 TENP LPLUNC6 LPLUNC3 LPLUNC4 P10 BPI PLTP

1 >55 >149 >30 >118 >112

>46

2

3

4

15 127 170 180 239 117 147 114 63 189 116 119

112 112 115 115 115 100 100 52 100

129 129 135 129 105 105 105 105 105 329 129 129

115 100

5

6

7

8

9

156 156 71 + 88 156 156 135 147 141 144

64 64 70 64 64 46 64 64 61

156 156

64 64

61 61 61 61 64 61 61 61 61 61 64 64

92 89 92 92 92 92 92 92 92 92 92 92

174 174 180 177 174 177 177 183 213 43 177 177

10

11

12

13

14

15

16

54 54 51 60 54 42 54 54 54 124 60 60

171 171 168 168 168 165 171 171 171

68 68 68 68 68 68 68 68 68

43 43 43 43 43 46 46 43 43

64 64 70 64 64 64 64 64 64

77 77 86 77 77 77 77 77 77

>368 >123 >533

168 165

68 68

43 43

64 64

77 77

>481 >279 >165 (64/>112)

>545 >300

290

S.-C. Chiang et al. / Developmental and Comparative Immunology 35 (2011) 285–295

from the mammalian proteins shown by the phylogenetic tree. With exception of the conserved proline residue at the C-terminus and the two cysteine residues in the N-terminal domain, which in BPI form a disulphide bond that maintains the three-dimensional structure of the protein (Beamer et al., 1997), there is no absolute conservation. This is in general agreement with the observed low sequence similarity between PLUNCs in mammals (Bingle et al., 2004; Wheeler et al., 2007). We have previously shown that LPLUNC proteins, with the exception of LPLUNC4/LPLUNC3, have less than 30% sequence identity between paralogues (Bingle et al., 2004). 3.4. Expression analysis

Fig. 2. Unrooted phylogenetic tree of BPI/LBP/PLUNC-like family members. An unrooted phylogenetic tree of chicken BPI/LBP/PLUNC-like proteins was generated as described using additional two-domain containing proteins from a range of species. Where a chicken protein is identified as a 1:1(or a 2:1 for cBPIL2a/2b) orthologue of a human protein the position of the branchpoint marking the most recent ancestral protein of the pair is marked with a small filled circle. The closer the circle is to the centre of figure, the more dissimilar is the orthologous pair. The distances that must be traced along the tree to connect two proteins are related to the sequence similarity of the proteins. Example sequence identities to provide scale are hLPLUNC4: mLPLUNC4 at 86%, hLPLUNC4: cLPLUNC4 at 58%, cLPLUNC4: cLPLUNC3 at 40% and cLPLUNC4; cLBP/BPI at 20%. Branches with bootstrap values <95% are coloured red; the detailed branching order is uncertain in these regions. The following sequences were retrieved from public databases and used for the analysis. Zebra finch (Taeniopygia guttata). tgBPI, XP 002192404.1; tgCETP, XP 002197982.1; tgPLTP, XP 002191962.1. Zebra fish (Danio rerio). drPLTP, NP 001003519.1; drCETP, NP 001007361.1. Puffer fish (Tetraodon nigroviridis). tnBPILBP, CAF96904.1; tn1, CAG03233.1; tnPLTP, CAF90160.1. Atlantic cod (Gadus morhua). gmBPILBP1, AAM52335.1; gmBPILBP2, AAM52336.1. Trout (Oncorhynchus mykiss). omLBPBPI1, NP 001118057.1; omLBPBPI2, NP 001117670.1. Catfish (Ictalurus punctatus). ipBPILBP, AAX20011.1. Pacific oyster (Crassostrea gigas) cgLBP/BPI, AAN84552.1. Pipid frog (Xenopus laevis). xlCETP, NP 001088804.1; xlBPI1a, NP 001089628.1; xlBPI1b, NP 001086208.1; xlPLTP, NP 001087767.1; xl2, NP 001088621.1. Cow (Bos taurus). bBPI3, XP 592903.2; bLBP, NP 001033763.1; bBPI, NP 776320.1. Human (Homo sapiens). hLBP, NP 004130.2; hBPI, NP 001716.2; hCETP, NP 000069.2; hPLTP, AAH19847.1; hLPLUNC1, AAH08429.1; hLPLUNC4, NP 872325.2; hLPLUNC3, NP 872599.1; hLPLUNC2, NP 079503.1; hLPLUNC6, NP 777557.1; hBPIL2, NP 777592.1. Mouse (Mus musculus). mBPI, Q67E05.1; mLPLUNC1, NP 700467.2; mLPLUNC5, NP 659139.2; mLPLUNC3, NP 919338.2; mLPLUNC2, NP 079907.2; mLPLUNC6, Q8BU51.2; mBPIL2, NP 808440.2; mPLTP, AAH03782.1; mLPLUNC4, NP 001030047.2; mLBP, NP 032515.2. (For interpretation of the references to colour in this figure legend, the reader is referred to the web version of the article.)

surrounds the presumptive location of this gene (immediately adjacent to BPI) has a number of gaps in the assembly and it remains a formal possibility that a chicken LBP gene is located in a region that has been incorrectly assembled. However no clear LBP orthologues exists in species that diverged prior to the avian/reptilian branch. Fish have only a single (or duplicated) BPI/LBP-like protein (Inagawa et al., 2002; Kono and Sakai, 2003), while X. laevis (and S. tropicalis, results not shown) has two distinct BPI/LBP-related proteins both of which group in the BPI branch of the tree (Fig. 2). Multiple sequence alignment of the chicken proteins shows an extremely low degree of sequence conservation (Fig. 3), an observation that is also shown by the divergence of the chicken orthologues

As some of the chicken BPI/LBP/PLUNC-like genes did not have any cDNA or EST support we generated primer pairs that could be used for RT-PCR for confirmation of their expression. We excluded analysis of CETP and PLTP, which have previously been studied in a range of tissues (Sato et al., 2007; Saarelaa et al., 2009). An initial screening using pooled cDNAs from healthy tissues followed by cloning and sequencing confirmed transcription of all ten genes. Having established that we could amplify all of the chicken genes we then used a large cDNA panel to investigate the tissue specific expression of nine of the genes (not including the presumptive pseudogene, P10) (Fig. 4). It is clear that cBPI exhibits the widest distribution of expression with the other genes having a more restricted expression profile. The five proteins from the “LPLUNC” portion of the locus have a varied distribution pattern. Most strikingly all are expressed within tissues of the reproductive tract including tissues associated with egg laying. The other organ system that appear to expresses the majority of these genes is the gastrointestinal tract including the salivary gland. With the exception of cBPI, the respiratory tissues show a more restricted expression of the other PLUNC/BPI proteins. LPLUNC3 and LPLUNC6 are expressed in lung whereas LPLUNC3 and LPLUNC4 are expressed in the trachea. Interestingly the two BPIL2 genes exhibit a distinct expression pattern although both seem to be most highly expressed in tissues from the reproductive tract. In this analysis TENP appears to have the most restricted expression pattern. This initial transcriptional study serves two purposes. Firstly, it confirms that all of these genes do exist as transcribed RNA species and secondly, it shows that they exhibit distinct expression profiles suggesting that they are not co-regulated. 4. Discussion Our systematic analysis confirms the existence of a portion of the PLUNC branch of the LBP BPI CETP domain containing superfamily in the chicken. Our previous analysis of wider PLUNC/BPI family had confirmed that TENP was a member but could not unequivocally place it on the PLUNC branch (Bingle et al., 2004). The subsequent identification and cloning of Ovocalyxin-36 had confirmed that additional related genes were present in the chicken genome (Gautron et al., 2007). Our analysis confirms that these two proteins are avian members of the “PLUNC” branch of the family and that an additional 3 related genes exist. The clustering of these seven structurally similar genes adjacent to BPI adds support to the hypothesis that PLUNCs arose from a series of duplication events (Bingle et al., 2004; Wheeler et al., 2007). Specifically, the absence of members of the SPLUNC branch of the family and the LPLUNC1/LPLUNC5 arm of LPLUNCs in chicken implies that these proteins arose only after the speciation of mammals. Our identification of the chicken PLUNC/BPI repertoire along with further analysis of additional genes from other species allows us to make some further suggestions as to the evolutionary origins of the wider gene family. This is represented in the schematic

S.-C. Chiang et al. / Developmental and Comparative Immunology 35 (2011) 285–295

tree shown in Fig. 5. This schematic suggests that the family likely arose from a single domain containing precursor gene as both single and two-domain containing proteins are found in invertebrates (Kolodziejczyk et al., 2008; Gonzalez et al., 2007; Barker

291

et al., 2008). Common ancestors of the vertebrates appear to have evolved PLTP, CETP and a BPI-like molecule as these proteins are found in a range of fish. In some fish, for example atlantic cod and trout, the BPI-like protein encoding gene has undergone duplica-

|BPIL2a| |BPIL2b| |LPLUNC4| |LPLUNC3| |ovo36| |BPI| |LPLUNC6| |PLTP| |BPI/LBP| |CETP| |TENP|

1 1 1 1 1 1 1 1 1 1 1

----------------------------------------ITQRGLDYGRKIGIELLKQS -------------MVKICCSLLLLSLLSVQLKANPGLKVRITQKALEYAKKVGVEILKKN ------------MLTALSIAVLYALLSPALSQLP--TDAVLRLNKGVLSDALAGSLQHGA -------------MGVLWVVFLTCGLLTSSQGLPGSASVSARVNKDMLESAITGPLANGN -----------MKPLKLFGMVVFCGLLSPTQGVLSGLSCAISPR--AMQQVLSDAIIQTG ----------MAARSVAVFGVVLDVFLVLTAATNPGFVVRITQAGLDYAHQHGITVLQKE ---------------MLWCVLLLGGCLSAS-QSAGGPEAILRMDVGTISRAVSTVLNESD -----------MAAGSQLLLLLLLPGLTAASHSPPGCKIRITSKGLDLVKHEGLRFVEQE -------------------------MFRSNQPIHPRMDIGVTGPCCPLPLTWEVDPPWDL MLWAGGMRLGTARILLMLVHAAAACEFGPMPYSVTGIVFRMTKPAALLLNQETARLIQAA ------------------MGALLALLDPVQPTRAPDCGGILTPLGLSYLAEVSKPHAEVV

|BPIL2a| |BPIL2b| |LPLUNC4| |LPLUNC3| |ovo36| |BPI| |LPLUNC6| |PLTP| |BPI/LBP| |CETP| |TENP|

21 48 48 50 48 51 45 50 36 61 43

VLKETFPSWSGQE----------------------RFSIVKVNYTVSRFKVDAVDIPETS MEKEQFPDLIGYE----------------------RFGLGNVHYNISRIRVTAVEFPNVS VLQGALGDLPISD---GGPSGTAGLLGGGLLGVLGDGGLLSTAQGLTGLRIVELTLPTVS LLQGLLGGLLSPDGLLGGLLGPSGLLGG--RGLLGKDGLLGTVQGLTGLRIVNITLPKIT LLEKHLQGMALPN-------------------IMSDRGLLSSSTIITGLHLERSWLPTLS LAQLKLPDISGDFP---------------------VRHLGKVHYEISSLNLRSFQLPYSR VLQKLVEGAAKKK------------------------ATMKPIKGISGLKVMELRAAEVA LENITVSDLHGKE--------------------------GQFHYNISQVKVMDLQLPFSN LPLLATVRLGMGH---------------------------------LGIHIHELQMNDST FKNAKFPNITGERS---------------------MRFLGTVAYTLANIQVSDLSIEQSE LRQDLMPKEPQTCS--------------------------LAPWSPAGTELPAVKVADLW

|BPIL2a| |BPIL2b| |LPLUNC4| |LPLUNC3| |ovo36| |BPI| |LPLUNC6| |PLTP| |BPI/LBP| |CETP| |TENP|

59 86 105 108 89 90 81 84 63 100 77

|BPIL2a| |BPIL2b| |LPLUNC4| |LPLUNC3| |ovo36| |BPI| |LPLUNC6| |PLTP| |BPI/LBP| |CETP| |TENP|

118 145 154 158 142 149 131 143 122 160 123

ASFIPGTGVSLSVAHVSATISADWRVKAWLLKDQGGFTLSISELFMAIVFQVSRDSTGHISLIPRSGVKLVIRNASLTIDMNWNIRTWMFKDGGRSTVHISKVFVTATFSTPLDSIGHLRLLPGIGFHLNLYTRVALNGR---------SLLG-LLDIAVEVNITSRVRLTMDGTGYLRFLPGIGLQLNIYTQLLIDGN---------GAVGSLLQLQVEANITARVRLAQDKSGAIALLPGIGMQLVVTVHLDLSGN------CLMGILSEVIAISLDVTITSNIKSTSFELGTISLVPNVGLHVAISNAFAEVDGNWRVKFHFIRDHGSFDLEVKNVYIKIDLKLGNDASGKLWLSPGVGVSMAVPVRMTLTGK---------SFVGGKMDIPMAANLSASSRVVQDMHGCLHFQPQQHLAFNINNASISLRFRRQLLYWFFYDIGSINASADGVHIHTVLQLAKDEVGRVDFAEDVGVQLTVHRARIQLNATWQAQLGAWQDSGSLRLRIRDLAVAVLLGLGADEHGHVELKENDAIDIAIKNVTAFFRGTLTYGYAGAWFLQLFHSVDFEIQSSIDLQINIKLLCQE LSVIPEAGLRLGIEVELRIAPLH-------------TVPMPVRISIRADLHVDMGPDGN*----------------------------------------* --LSVLLHSCQLSIGSVKVKLN--EGSSWIYSFLSGFLEKAVHSKLNENICLNIKYKIQM --TSVSLSSCHTTSGDTDIKVN--GKSGFLHDFFIKYLKKPIHRSLATNSCPNIRSGIQM --PKLVVEKCNTLLGGMKVR-----LLRGLLPVVDNLLAGVLNRLLPNLLCPVLDVALGL --LRLVVEDCKTLLGDIHIRVGF-LLPRPKVPLVEKTLKSVLGNVLPRLLCPVVDTVLGV --VHVTVDDCFCILGAVKIK----LISGLLSLSVHDMVFSHLTATLPGLLCPVMDAVSEI --PTVSTSACSTRISSVHVHFS--GKFGWLYNLFYSAVESRFRKILEGKVCDSVVSSVNG --PRLSTGRCHVVLLHSWANLP----HRMLPLIMSKFLDSTLQKALRGLLCPAMDVVLDL --LKISNMSCNASIARMHAGFS--GTLRKVYEFLSTFIVTGMRFLLSQQICPSLEHASLV --PSVWDAGCDARGTDLRLEFR--RGQSWLYNLLVPLLQRTLRQQLNKQLCVEIQKGISR EQVAADASDCYLSFHKLMLHLQGDKEPGWLKQLFTDFISFTLKFVLKRELCKEINLLAQV --LQLLTSACRPTVQAQSTREAE---SKSSRSILDKVVD-------VDKLCLDVSKLLLF

|BPIL2a| |BPIL2b| |LPLUNC4| |LPLUNC3| |ovo36| |BPI| |LPLUNC6| |PLTP| |BPI/LBP| |CETP| |TENP|

174 201 207 215 196 205 185 199 178 220 171

MDAQLR-KQKVLSQIDA------FAQIDYSLVSSPAVFKSHINLDLKGTVYPVGN--HTD IAKDFQ-SLNVPVRIDD------LAEIDYSLN-SLEVFRPYIDMDLKGIVYPAGN--YTG VNDQLG-LVNSLVPLGL------LGSIQYTVSSLPLVTGQFLEVDLNTVVGRVAGGLVDY VNSLLG-SVTSVLPLGA------LGNLQYTLSSLPIIGDKSIQLDLNLLLRDAEGNVVEP VNVQLLSTLNVVMPVGL------KGMVHYHLVGPPFTSGSSLMMDLDGTVQQMGG---SI DLQRYLQTLPVTAKIDA------KAGIDYSLVAPPAATEQTLDVDLKGEFFSLAHR--GA VNAKFA-TMMYTIPIGN------AGMLRYALLNAPVVREAFIQLELKAILHSRDGEEVAQ LLNSLLDTVPVRNYVDE------HIGIDYSLLRDPVVSPETLDLDFKGMFFYRAREDQEL LQDSLKNMRASDQEAAWGRWPQGRAIVEGNGPSLASVKPYIIHLSVHAGRVLGVHG-RWQ MANFVHNVAENFVQDEA-------IGLDISLASDPLIKANYLESHHKGLVLYKNYSDVLS PNEQLMSLTALFPVTPN-------CQLQYLALAAPVFSKQGIALSLQTTFQVAGAVVPVP

|BPIL2a| |BPIL2b| |LPLUNC4| |LPLUNC3| |ovo36| |BPI| |LPLUNC6| |PLTP| |BPI/LBP| |CETP| |TENP|

225 251 260 268 247 257 238 253 237 273 224

PPFVPAPFDLPNKI----------DSMLYLGVSNYFLKSATLAYYRAGVFNITISKDLAA PPYVATPFAIPDQN----------DSMLYLAFSEYFFQTSLFSYYTAGAFNITIAKETCR PLGRPESVPTPPRVPMPPLPPMPDSSSSQLGLSVSFLSSVLAALQKEGALDLDISNAMYP AGDLSMPVTLPPAV----------GPGAQLGLSQGVLGAVLALAQRQGAFSMDISSSAVP IPHDSYASTLPPLL----------DGLLVIILRQSFLSSLLALLLHIQPYTFPCSSEAFS VPFQPPALALPPDH----------DRMVYFGASSYFFNTAGFAYHAAGALVFEITDSMIP PSDLPPLTSLPPKR----------EAATQLILAASFLSAELSIMQ--AFFGLNITNGMVL ENHAVEPVIKETER------------MVYVAFSEYFFDSAMHAYFQASVLAMQLEGEKVP NPFSAQPVGLPELQ----------EPMLLVAITEFVANTAAFVYFTAGALRRNITAEMLP DSVFS-PSLLSESR------------MLYFWISEHILNSLASAAFLDGRLVLAIRGEKLQ VSPVPFSMPELASTS---------TSHLILALSEHFYTSLYFTLERAGAFNMTIPS----

Fig. 3. Multiple sequence analysis of chicken BPI/LBP/PLUNC-like proteins. The predicted amino acid sequences of chicken BPI/LBP/PLUNC proteins were aligned using CLUSTALX. In the alignment, identical residues (found in >7 sequences) are indicated by the white on black background, whereas similar residues (conserved in >7sequences) have the grey background. Spaces introduced for maximum alignments are indicated by a -. The positions of the conserved cysteine residues and the disulphide bond are indicated by *—-*. The numbers indicate the amino acids.

292

S.-C. Chiang et al. / Developmental and Comparative Immunology 35 (2011) 285–295

|BPIL2a| |BPIL2b| |LPLUNC4| |LPLUNC3| |ovo36| |BPI| |LPLUNC6| |PLTP| |BPI/LBP| |CETP| |TENP|

275 301 320 318 297 307 286 301 287 320 271

AFN---LTTAILKDFVPEIALHCPTACPVLLKLMATSPPVVSLQSDTCRLWITGSVEVFA YLN---ISTEMFGSIIPEIAKYPIIPYPVMMKLTATEIPLVSLQQDSFTLEIRESMEVFA ELPP--LTTPTLGALVPAVLKAYPEPCDLLLKIAVPKAPVVTLKKDKAAIQLQATAEVVA NSIP--LTTSALLSAFPQLSTVLPGSLPLALRVRLADTPAVAVRDGKATATLRAAIDVLA GAN---QLRDSITDLYPTGCTSCPAASPLSIRVECVGNPILLLEPNKATVELSVLLQVFV KGVEFHLNTSTFAAFIPQLDKMYPN-MLMKLRLSAPSAPFLSITPGGISLQPVADIQAYA GLLP--LVTTMLGALIPEISSMLPPSQPVVIEMRETQPPLVTITPEKSTVHLFSTAEFWA KDLEVLLRATFFGTIF--MLNPAVVDAPLRLVLQVSAPPRCVIKPSGTSISVSAFLNISL RRFPLKLNTESMGSFAPQLQQHFPS-CPMELHLWARRQPLLSCHPNALHGALFGSAEAFV ALFE--FEDTEAQQKAVHLIFQGNSYNDSVAKVWSLALPEISLQPEGTVVKSLVAVEISI -----MLTTATLAQKITQVGSLYHEDLPITLSAALRSSPRVVLEEGRAALKLFLTVHIGA

|BPIL2a| |BPIL2b| |LPLUNC4| |LPLUNC3| |ovo36| |BPI| |LPLUNC6| |PLTP| |BPI/LBP| |CETP| |TENP|

332 358 378 376 354 366 344 359 346 378 326

VLPNSTIQYIFTGNLTTSTRGNLTVIKQKLIISILLKRLQ-FSLLHSAAGFSQVSLVENF VLPDSTTQSLFTVNVAANTSIALNVFDQKLTGSLCLNRLQ-FSLAHSNVGSFEISFLENI IHSADVQKFLCLLNIDASLLAQFAVEANKLKMTASLEKTE-LSLVSSSIGDFDISLMEML QRPGFPPQTLFSLDSDVVLDITPSVSGGRLRTALAVDRVS-LRVASSQLGSINVSRLEGW KRPDGSVIILLLLKADLSLNVRLSISRGSLMLAFSLSRVS-LFLESSDIGISEISNLKPH ILPNTSLAPLFLLSLTGNVSATIDVKSGHIVGKLSVGRMK-LSLKHSDVGTFQVRMLQSI SSSSSAPGSLFVLDVHSELGVRFAVAEERLQFSLTLHSVSHVAVVNSSIGAFNVLPLRGV VPADRPAVQLSSMAMESKLSAKVYLQGKALRVQLDLRRFR-IYSKQSALESLALFSLQAP VLPNATRVPAFLLNIDANVTAKPTIAGNRLGGTVGLQSLS-VVQVMSHVGPLQVQKLENM FPPGEEPLTALYMEEEITVTIQAAYVEKKLILRPVDSQIEFKVFNCTADPSGNDQSVRNF GSPDFQSFLSVSADVTR-AGLQLSVSDTRMMISTAVIEDAELSLAASNVGLVRAALLEEL

|BPIL2a| |BPIL2b| |LPLUNC4| |LPLUNC3| |ovo36| |BPI| |LPLUNC6| |PLTP| |BPI/LBP| |CETP| |TENP|

391 417 437 435 413 425 404 418 405 438 385

LSYTLRRVVIPVINDKLGKGFPLPNLAH----TSLVGPVIKMNQGHLVIFSDVHYKHEQG LSYILQTEVIPSANAKLSKGFPLPNLAN----IILTRPHITIAQGYVLISTDAHYKH--INKVFDAAFLPALNAVLGHGVPLPRLLN----IDFTNADIYVILVSTALCTPP------VKDILAAAYVPAINNAVGMGIPLPNIFN----TNFENGQVDLADVRLTLVLAP------LTKLLVEIYLPRLNAVAADGIPLPDVFG----ITLMGAELQILLGLLAISV--------MNVYASSILLPRVNERLAEGFPLPLPDR----IQLSNILVQFHQNFLLLGADVHYTPRER LADIIHVAYVPSVNRALRGGVPLPPLLG----TPYQRVELRQIQDGLVLDVPVVEP---LKTLLQLTIMPIINERTKKGVQIPLPEG----MDFTREVVTNHAGFLTVGADLHFSKGLR LKFGLWLFGVPWANKRLRPGVPLPTPHG----ITLLHPHLSLHEGFMLITTDLRYEP--LQKmISAVGIPEVISKIEPALTSLMNSKGLHLFEIKNPEIITRKRYLIVQLDFSFPNHLL FLAPVCQQVPAWMDDVLREGVHLPHMSH----FTYTDVNVVVHKDYVLVPCKLKLRSTMA

|BPIL2a| |BPIL2b| |LPLUNC4| |LPLUNC3| |ovo36| |BPI| |LPLUNC6| |PLTP| |BPI/LBP| |CETP| |TENP|

447 EDEDLHRHP----------------------------------------------------------------------------------------------------------------------------------------481 R---------------------------------------------------------474 EVIEKYRSAPAVPAEPTVQTTAASTGPHQL -----------------------------498 LDFLEKTL---------------------441 -----------------------------Fig. 3. (Continued ).

tion to yield two closely related molecules (Inagawa et al., 2002; Kono and Sakai, 2003). We suggest that LPLUNCs arose before the divergence of the synapsids (leading to mammal-like reptiles) and the sauropsids (leading to birds and reptiles) and are essentially common to all vertebrates. Pipid frogs (S. tropicalis and X. laevis) appear to have a number of genes (which are partially supported by EST sequences), corresponding to proteins with similarity to LPLUNC2, LPLUNC3, LPLUNC4 and LPLUNC6. We further propose that BPIL2 proteins arose after this divergence but before the therian divergence. The most significant expansion of the wider family appears to have arisen within the therian linage. Here we see the appearance of LBP as well as the significant expansion of the PLUNC sub-family of proteins including the evolution of LPLUNC1/5 and the SPLUNC branch. Both marsupials (grey short tailed opossum) and monotremes (platypus) have both groups of proteins. We have used RT-PCR with primers based on gene predictions for LPLUNC1, SPLUNC1 and SPLUNC2 to generate partial sequences for all three of these proteins from marsupials (results not shown) and a partial wallaby LPLUNC1 protein has been identified (Kwek et al., 2009). This schematic also highlights the diversification that has occurred in the SPLUNC portion of the family during the evolution of the eutherian mammals. We, and others, have previously highlighted this divergence, which includes examples of, expansion of paralogues, generation of pseudogenes and gene loss (Bingle and Craven, 2002; Bingle et al., 2004; Wheeler et al., 2007; Mulero et

al., 2002). This divergence is also accompanied by loss of sequence conservation between orthologous proteins. The absence of a presumptive LBP orthologue in chicken has important implications for the LBP-mediated portion of the LPS handling pathways. In mammals, LBP transfers LPS to CD14 on the surface of inflammatory cells, which in term transfers LPS to TLR4 via MD-2 (Palsson-McDermott and O’Neill, 2004). Unlike most other TLRs, activation of TLR-4 initiate intracellular induction of two pathways with opposing effects: the MyD88/TIRAP pathway leads to activation of NF-␬B and AP1 (Akira and Takeda, 2004); while the TRAM/TRAF pathway leads to IRF3-mediated inhibition of NF-␬B release and production of IFN␤ (Tanimura et al., 2008; Kagan et al., 2008). Although the chicken appears to have orthologues to MD-2, TLR4 (Malek et al., 2004) and CD14 (Keestra and van Putten, 2008; Wu et al., 2009), it seems to lack functional orthologues for TRAM, TRAF, TRIf and IRF3 (Keestra and van Putten, 2008; Cormican et al., 2009), supported by failure of LPS-induced INF␤ production via the TRAM/TRAF pathway (Keestra and van Putten, 2008). The implication of this observation is that the MyD88/TIRAP signalling pathway has arisen later in evolution, and may explain the observations that birds and some fish species are more resistant to endotoxic shock than mammals (Adler and DaMassa, 1979; Berczi et al., 1966; Iliev et al., 2005). From this study it is clear that chicken PLUNCs are expressed in a wide range of tissues, many of these are sites where mucosal/innate

S.-C. Chiang et al. / Developmental and Comparative Immunology 35 (2011) 285–295

293

Fig. 4. Expression analysis of chicken BPI/LBP/PLUNC-like proteins. Expression of chicken BPI/LBP/PLUNC-like genes was studied by PCR in multiple tissue samples using exon spanning primer pairs to each individual gene as described in the materials and methods section. Expression of ␤-actin (as a PCR control) was also monitored in the same samples.

immunity is expected to play an important role. Our analysis represents expression at steady state and provides no indication of induction or regulation during infection and inflammation. BPI, most abundantly expressed on neutrophils and eosinophils in human (Levy, 2000), is expressed almost constitutively in the chicken tissues, as confirmed by consistent results with different primer sets and multiple negative controls. Although tissue contamination by granulocytes is a possibility, the intensity of

(BPIL2 ) BPIL2a, BPIL2b

amplification observed is higher than would be expected as the transcriptional activities of granulocytes are highest in the bone marrow and quite low in the peripheral circulation. It can therefore be concluded that BPI is expressed in tissue types different from the major sites of expression in human. Recently, additional expression sites of BPI have been noted including inducible expression in gut, respiratory and reproductive epithelium (Canny and Levy, 2008; Canny et al., 2002, 2006). A similar interspecies differ-

(LP2 ) TENP, OVO36

LP3, LP6 still exist but highly divergent (SP2 dupl.to) BSP30A BSP30B BSP30C BSP30D

BPIL2 LP2 LP3 LP4 LP6 Single domain precurso r

BPI CETP PLTP

Chicken (Birds)

LBP

LP1, LP5, SP1, SP2, SP3, SP5, SP6, BASE

SP6 Bovine

BPI3 LP5 SP6

BASE

Human

Chimp

BASE Partial predictions exist of LP2,3,4,6 in X. laevis

(BPI

)

BPIa, BPIb

SP4 (SP1 dupl. to) SP5

CETP

Rat SP4 Mouse Frog Toad

BPILBP Fish Fig. 5. Schematic representation of the evolution of the BPI/LBP//PLUNC-like genes. The tree illustrates the evolution of the wider BPI/PLUNC-like gene family during vertebrate evolution. Fish represent the most divergent vertebrate ancestors in which clear orthologues exist. Black filled circles represent the earliest origin of clearly defined orthologues. Open circles with crossed out symbols represent gene loss in a lineage.

294

S.-C. Chiang et al. / Developmental and Comparative Immunology 35 (2011) 285–295

ence in expression has also been observed with murine BPI, which is strongly expressed in the testis, in addition to bone marrow granulocytes (Lennartsson et al., 2005). As suggested in the introduction there is little known of the expression of the other chicken PLUNC proteins. Ovocalyxin-36 was found to be expressed in the infundibulum, magnum, isthmus, and uterus of the female reproductive tract (Gautron et al., 2007), although these studies did not analyse expression in a comprehensive set of tissues. It has also been reported in proteomic studies of chicken eggs (Mann, 2008). More recent studies have also confirmed that members of this gene family are found in tissues associated with egg production and within eggs themselves (D’Alessandro et al., 2010; Dunn et al., 2009; Jonchère et al., 2010). Our studies suggest that rather than being expressed exclusively in reproductive tissues associated with egg production, the protein is abundantly expressed in the digestive tract. The other previously studied PLUNC protein, TENP, was initially found to be expressed in the adult and embryonic brain and retina, although again this study did not include a wide range of tissues (Yan and Wang, 1998). Consistent with our expression data, TENP protein has also been shown to be present in the magnum, the part of the female reproductive tract responsible for secretion of egg white as well as in egg white (Mann, 2008). Although genes in the “LPLUNC” portion of the family exhibit a widespread distribution a number of the other genes, principally LPLUNC4 and LPLUNC6 are also expressed in the digestive tract. Currently there is no published evidence that mammalian orthologues of these genes are expressed in these tissues. As the original murine PLUNC was found to be restricted to the upper respiratory tract and oral cavity (Weston et al., 1999) and we have subsequently shown that other family members are often highly expressed in this region (Bingle and Craven, 2002; Bingle et al., 2005, 2009, 2010), we were interested in identifying chicken PLUNCs that are expressed in these tissues. Our analysis suggests that a number of these genes are expressed in these tissues but that none of them exhibit specificity for the respiratory tract. Again, this may not be totally unexpected. The two most highly expressed pulmonary-restricted PLUNCs in human and mouse, are SPLUNC1 and LPLUNC1 (Bingle et al., 2005, 2010; Barnes et al., 2008), which are both absent in chicken. It remains an open question as to why the SPLUNC and LPLUNC1/5 arms of the wider protein family is absent below the therian lineage. It is tempting to speculate that these genes have co-evolved with the development of the alveolarised lung that first developed in the monotreme lineage (Ferner et al., 2009). Birds have previously been noted to lack other additional pulmonary genes. For example genes for Surfactant protein B and Surfactant protein C, both critical for the function and defence of the alveolarised lung have not as yet been reported in the chicken genome (Hogenkamp et al., 2006; Hughes, 2007). Recent studies have suggested that SPLUNCs may function as surfactant molecules (McDonald et al., 2009; Gakhar et al., 2010), and perhaps these functions are not essential for the avian lifestyle.

5. Conclusions In summary, our comprehensive bioinformatic and expression analysis has identified a total of five PLUNC homologues in chicken, all of which appear to be LPLUNCs. They are structural orthologues of LPLUNC2, 3, 4 and 6. One additional avian-specific LPLUNC (BPI/LBP) has also been identified. Chicken orthologues of BPI, CETP, PLTP, BPIL2 have also been confirmed. In contrast to mammals, there appears to be no LBP in avians, which possibly attributes to the higher LPS sensitisation threshold in birds relative to mammals. Additional expression and functional analysis of this complex gene family are required to elucidate their putative host defence function.

Acknowledgements The authors acknowledge Richard Talbot for genomic DNA and Douglas Rhodes for chicken ESTs. References Adler, H.E., DaMassa, A.J., 1979. Toxicity of endotoxin to chicks. Avian. Dis. 23, 174–178. Akira, S., Takeda, K., 2004. Toll-like receptor signalling. Nat. Rev. Immunol. 4, 499–511. Altschul, S.F., Gish, W., Miller, W., Myers, E.W., Lipman, D.J., 1990. Basic local alignment search tool. J. Mol. Biol. 215, 403–410. Barker, A.R., Wickstead, B., Gluenz, E., Gull, K., 2008. Bioinformatic insights to the ESAG5 and GRESAG5 gene families in kinetoplastid parasites. Mol. Biochem. Parasitol. 162, 112–122. Barnes, F.A., Bingle, L., Bingle, C.D., 2008. Pulmonary genomics, proteomics, and PLUNCs. Am. J. Respir. Cell Mol. Biol. 38, 377–379. Beamer, L.J., Carroll, S.F., Eisenberg, D., 1997. Crystal structure of human BPI and two bound phospholipids at 2.4 angstrom resolution. Science 276, 1861–1864. Berczi, I., Bertok, L., Bereznai, T., 1966. Comparative studies on the toxicity of Escherichia coli lipopolysaccharide endotoxin in various animal species. Can. J. Microbiol. 12, 1070–1071. Bingle, C.D., Craven, C.J., 2002. PLUNC: a novel family of candidate host defence proteins expressed in the upper airways and nasopharynx. Hum. Mol. Genet. 11, 937–943. Bingle, C.D., Craven, C.J., 2004. Meet the relatives: a family of BPI and LBP-related proteins. Trends Immunol. 25, 53–55. Bingle, C.D., LeClair, E.E., Havard, S., Bingle, L., Gillingham, P., Craven, C.J., 2004. Phylogenetic and evolutionary analysis of the PLUNC gene family. Protein Sci. 13, 422–430. Bingle, L., Cross, S.S., High, A.S., Wallace, W.A., Devine, D.A., Havard, S., Campos, M.A., Bingle, C.D., 2005. SPLUNC1 (PLUNC) is expressed in glandular tissues of the respiratory tract and in cancers with a glandular phenotype. J. Pathol. 205, 491–497. Bingle, L., Barnes, F.A., Lunn, H., Musa, M., Webster, S., Douglas, C.W.I., Cross, S.S., High, A.S., Bingle, C.D., 2009. Characterisation and expression of SPLUNC2, the human orthologue of rodent parotid secretory protein. Histochem. Cell Biol. 132, 339–349. Bingle, C.D., Wilson, K., Lunn, H., Barnes, F.A., High, A.S., Wallace, W.A., Rassl, D., Campos, M.A., Ribeiro, M., Bingle, L., 2010. Human LPLUNC1 is a secreted product of goblet cells and minor glands of the respiratory and upper aerodigestive tracts. Histochem. Cell Biol. 133, 505–515. Canny, G., Levy, O., 2008. Bactericidal/permeability-increasing protein (BPI) and BPI homologs at mucosal sites. Trends Immunol. 29, 541–547. Canny, G., Levy, O., Furuta, G.T., Narravula-Alipati, S., Sisson, R.B., Serhan, C.N., Colgan, S.P., 2002. Lipid mediator-induced expression of bactericidal/permeabilityincreasing protein (BPI) in human mucosal epithelia. Proc. Natl. Acad. Sci. U.S.A. 99, 3902–3907. Canny, G., Trifonova, R.T., Kindelberger, D.W., Colgan, S.P., Fichorova, R.N., 2006. Expression and function of bactericidal/permeability-increasing protein in human genital tract epithelial cells. J. Infect. Dis. 194, 498–502. Chu, H.W., Thaikoottathil, J., Rino, J.G., Zhang, G., Wu, Q., Moss, T., Refaeli, Y., Bowler, R., Wenzel, S.E., Chen, Z., et al., 2007. Function and regulation of SPLUNC1 protein in Mycoplasma infection and allergic inflammation. J. Immunol. 179, 3995–4002. Cormican, P., Lloyd, A.T., Downing, T., Connell, S.J., Bradley, D., O’Farrelly, C., 2009. The avian Toll-like receptor pathway – subtle differences amidst general conformity. Dev. Comp. Immunol. 33, 967–973. D’Alessandro, A., Righetti, P.G., Fasoli, E., Zolla, L., 2010. The egg white and yolk interactomes as gleaned from extensive proteomic data. J. Proteomics 73, 1028–1042. Dunn, I.C., Wilson, P.W., Lu, Z., Bain, M.M., Crossan, C.L., Talbot, R.T., Waddington, D., 2009. New hypotheses on the function of the avian shell gland derived from microarray analysis comparing tissue from juvenile and sexually mature hens. Gen. Comp. Endocrinol. 163, 225–232. Elsbach, P., Weis, J., 1998. Role of the bactericidal/permeability-increasing protein in host defence. Curr. Opin. Immunol. 10, 45–49. Felsenstein, J., 1989. PHYLIP – Phylogeny Inference Package (Version 3.2). Cladistics 5, 164–166. Fenton, M.J., Golenbock, D.T., 1998. LPS-binding proteins and receptors. J. Leukoc. Biol. 63, 25–32. Ferner, K., Zeller, U., Renfree, M.B., 2009. Lung development of monotremes: evidence for the mammalian morphotype. Anat. Rec. 292, 190–201. Gakhar, L., Bartlett, J.A., Penterman, J., Mizrachi, D., Singh, P.K., Mallampalli, R.K., Ramaswamy, S., McCray, P.B., 2010. PLUNC is a novel airway surfactant protein with anti-biofilm activity. PLoS One 5, e9098. Gautron, J., Murayama, E., Vignal, A., Morisson, M., McKee, M.D., Réhault, S., Labas, V., Belghazi, M., Vidal, M.L., Nys, Y., et al., 2007. Cloning of ovocalyxin-36, a novel chicken eggshell protein related to lipopolysaccharide-binding proteins, bactericidal permeability-increasing proteins and PLUNC family proteins. J. Biol. Chem. 282, 5273–5286. Geetha, C., Venkatesh, S.G., Dunn, B.H., Gorr, S.U., 2003. Expression and anti-bacterial activity of human parotid secretory protein (PSP). Biochem. Soc. Trans. 31, 815–818.

S.-C. Chiang et al. / Developmental and Comparative Immunology 35 (2011) 285–295 Ghafouri, B., Kihlström, E., Ståhlbom, B., Tagesson, C., Lindahl, M., 2003. PLUNC (palate, lung and nasal epithelial clone) proteins in human nasal lavage fluid. Biochem. Soc. Trans. 31, 810–814. Gonzalez, M., Gueguen, Y., Destoumieux-Garzón, D., Romestand, B., Fievet, J., Pugnièr, M., Roquet, F., Escoubas, J.M., Vandenbulcke, F., Levy, O., et al., 2007. Evidence of a bactericidal permeability increasing protein in an invertebrate, the Crassostrea gigas Cg-BPI. Proc. Natl. Acad. Sci. U.S.A. 104, 17759–17764. Guérin-Dubiard, C., Pasco, M., Mollé, D., Désert, C., Croguennec, T., Nau, F., 2006. Proteomic analysis of hen egg white. J. Agric. Food Chem. 54, 3901–3910. Haigh, B., Hood, K., Broadhurst, M., Medelea, S., Callaghan, M., Smolenski, G., Dinesa, M., Wheeler, T.T., 2008. The bovine salivary proteins BSP30a and BSP30b are independently expressed BPI-like proteins with anti-Pseudomonas activity. Mol. Immunol. 45, 1944–1951. Hailman, E., Lichenstein, H.S., Wurfel, M.M., Miller, D.S., Johnson, D.A., Kelley, M., Busse, L.A., Zukowski, M.M., Wright, S.D., 1994. Lipopolysaccharide (LPS)binding protein accelerates the binding of LPS to CD14. J. Exp. Med. 179, 269–277. Hamiaux, C., Stanley, D., Greenwood, D.R., Baker, E.N., Newcomb, R.N., 2009. Crystal structure of Epiphyas postvittana Takeout 1 with bound ubiquinone supports a role as ligand carriers for takeout proteins in insects. J. Biol. Chem. 284, 3496–3503. Hogenkamp, A., van Eijk, M., van Dijk, A., van Asten, A.J., Veldhuizen, E.J., Haagsman, H.P., 2006. Characterization and expression sites of newly identified chicken collectins. Mol. Immunol. 43, 1604–1616. Hughes, A.L., 2007. Evolution of the lung surfactant proteins in birds and mammals. Immunogenetics 59, 565–572. Iliev, D.B., Roach, J.C., Mackenzie, S., Planas, J.V., Goetz, F.W., 2005. Endotoxin recognition: in fish or not in fish? FEBS Lett. 579, 6519–6528. Inagawa, H., Honda, T., Kohchi, C., Nishizawa, T., Yoshiura, Y., Nakanishi, T., Yokomizo, Y., Soma, G., 2002. Cloning and characterization of the homolog of mammalian lipopolysaccharide-binding protein and bactericidal permeabilityincreasing protein in rainbow trout Oncorhynchus mykiss. J. Immunol. 168, 5638–5644. International Chicken Genome Sequencing Consortium, 2004. Sequence and comparative analysis of the chicken genome provide unique perspectives on vertebrate evolution. Nature 432, 695–716. Jonchère, V., Réhault-Godbert, S., Hennequet-Antier, C., Cabau, C., Sibut, V., Cogburn, L.A., Nys, Y., Gautron, J., 2010. Gene expression profiling to identify eggshell proteins involved in physical defense of the chicken egg. BMC Genomics 11 (21 (January)), 57. Kagan, J.C., Su, T., Horng, T., Chow, A., Akira, S., Medzhitov, R., 2008. TRAM couples endocytosis of Toll-like receptor 4 to the induction of interferon-beta. Nat. Immunol. 9, 361–368. Keestra, A.M., van Putten, J.P., 2008. Unique properties of the chicken TLR4/MD2 complex: selective lipopolysaccharide activation of the MyD88-dependent pathway. J. Immunol. 181, 4354–4362. Kent, W.J., 2002. BLAT – the BLAST-like alignment tool. Genome Res. 12, 656–664. ˙ Kolodziejczyk, R., Bujacz, G., Jakób, M., Ozyhar, A., Jaskolski, M., Kochman, M., 2008. Insect juvenile hormone binding protein shows ancestral fold present in human lipid-binding proteins. J. Mol. Biol. 377, 870–881. Kono, T., Sakai, M., 2003. Molecular cloning of a novel bactericidal permeabilityincreasing protein/lipopolysaccharide-binding protein (BPI/LBP) from common carp Cyprinus carpio and its expression. Mol. Immunol. 40, 269–278. Kwek, J.H., Iongh, R.D., Digby, M.R., Renfree, M.B., Nicholas, K.R., Familari, M., 2009. Cross-fostering of the tammar wallaby (Macropus eugenii) pouch young accelerates fore-stomach maturation. Mech. Dev. 126, 449–463. Lennartsson, A., Pieters, K., Vidovic, K., Gullberg, U., 2005. A murine antibacterial ortholog to human bactericidal/permeability-increasing protein (BPI) is expressed in testis, epididymus, and bone marrow. J. Leukoc. Biol. 77, 369–377. Levy, O., 2000. A neutrophil-derived anti-infective molecule: bactericidal/permeability increasing protein. Antimicrob. Agents Chemother. 44, 2925–2931.

295

Malek, M., Hasenstein, J.R., Lamont, S.J., 2004. Analysis of chicken TLR4, CD28, MIF, MD-2, and LITAF genes in a Salmonella enteritidis resource population. Poult. Sci. 83, 544–549. Mann, K., 2008. Proteomic analysis of the chicken egg vitelline membrane. Proteomics 11, 2322–2332. Masson, D., Jiang, X.-C., Lagrost, L., Tall, A.R., 2009. The role of plasma lipid transfer proteins in lipoprotein metabolism and atherogenesis. J. Lipid. Res. 50 (Suppl.), S201–S206. McDonald, R.E., Fleming, R.I., Beeley, J.G., Bovell, D.L., Lu, J.R., Zhao, X., Cooper, A., Kennedy, M.W., 2009. Latherin: a surfactant protein of horse sweat and saliva. PLoS One 4, e5726. Mulero, J.J., Boyle, B.J., Bradley, S., Bright, J.M., Nelken, S.T., Ho, T.T., Mize, N.K., Childs, J.D., Ballinger, D.G., Ford, J.E., et al., 2002. Three new members of the lipid transfer/lipopolysaccharide binding protein family (LT/LBP). Immunogenetics 54, 293–300. Oishi, A., Gengyo-Ando, K., Mitani, S., Mohri-Shiomi, A., Kimura, K.D., Ishihara, T., Katsur, I., 2009. FLR-2, the glycoprotein hormone alpha subunit, is involved in the neural control of intestinal functions in Caenorhabditis elegans. Genes Cells 14, 1141–1154. Palsson-McDermott, E.M., O’Neill, L.A., 2004. Signal transduction by the lipopolysaccharide receptor, Toll-like receptor-4. Immunology 113, 153– 162. Qiu, X., Mistry, A., Ammirati, M.J., Chrunyk, B.A., Clark, R.W., Cong, Y., Culp, J.S., Danley, D.E., Freeman, T.B., Geoghegan, K.F., et al., 2007. Crystal structure of cholesteryl ester transfer protein reveals a long tunnel and four bound lipid molecules. Nat. Struct. Mol. Biol. 14, 106–113. Robinson, C.P., Bounous, D.I., Alford, C.E., Nguyen, K.H., Nanni, J.M., Peck, A.B., Humphreys-Beher, M.G., 1997. PSP expression in murine lacrimal glands and function as a bacteria binding protein in exocrine secretions. Am. J. Physiol. 272, G863–G871. Saarelaa, J., Metsoa, J., Schneiderb, W.J., Jauhiainena, M., 2009. Avian phospholipid transfer protein causes HDL conversion without affecting cholesterol efflux from macrophages. Biochim. Biophys. Acta: Mol. Cell. Biol. Lip. 1791, 781– 789. Sato, K., Ohuchi, A., Sato, T., Schneider, W.J., Akiba, Y., 2007. Molecular characterization and expression of the cholesteryl ester transfer protein gene in chickens. Comp. Biochem. Physiol. B: Biochem. Mol. Biol. 148, 117–123. Tanimura, N., Saitoh, S., Matsumoto, F., Akashi-Takamura, S., Miyake, K., 2008. Roles for LPS-dependent interaction and relocation of TLR4 and TRAM in TRIF signaling. Biochem. Biophys. Res. Commun. 368, 94–99. Thompson, J.D., Higgins, D.G., Gibson, T.J., 1994. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic. Acid. Res. 22, 4673–4680. Weiss, J., 2003. Bactericidal/permeability-increasing protein (BPI) and lipopolysaccharide-binding protein (LBP): structure, function and regulation in host defence against Gram-negative bacteria. Biochem. Soc. Trans. 31, 785–790. Weston, W.M., LeClair, E.E., Trzyna, W., McHugh, K.M., Nugent, P., Lafferty, C.M., Ma, L., Tuan, R.S., Greene, R.M., 1999. Differential display identification of plunc, a novel gene expressed in embryonic palate, nasal epithelium, and adult lung. J. Biol. Chem. 274, 13698–13703. Wheeler, T.T., Hood, K.A., Maqbool, N., McEwan, J.C., Bingle, C.D., Zhao, S., 2007. Expansion of the bactericidal/permeability increasing-like (BPI-like) protein locus in cattle. BMC Genomics 8 (15 (March)), 75. Wu, Z., Rothwell, L., Hu, T., Kaiser, P., 2009. Chicken CD14, unlike mammalian CD14, is trans-membrane rather than GPI-anchored. Dev. Comp. Immunol. 33, 97– 104. Yan, R.T., Wang, S.Z., 1998. Identification and characterization of TENP, a gene transiently expressed before overt cell differentiation during neurogenesis. J. Neurobiol. 34, 319–328.